Mouse Anti-AOX Antibody (MO-AB-36061W)


Cat: MO-AB-36061W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-36061W Monoclonal WB, ELISA MO36061W 100 µg
MO-AB-47338W Monoclonal Maize (Zea mays) WB, ELISA MO47338W 100 µg
MO-DKB-0045RA Polyclonal WB 50 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrench-bean, A. thaliana (Arabidopsis thaliana); B. nana (Betula nana); B. oleracea (Brassica oleracea); Berberis vulgaris; Eriophorum vaginatum; H. vulgare (Hordeum vulgare); Lupinus luteus; N. tabacum (Nicotiana tabacum); Rice (Oryza); P. abies (Picea abies); P. sativum (Pisum sativum), Maize (Zea mays)
CloneMO36061W
SpecificityThis antibody binds to French-bean AOX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-French-bean AOX Antibody is a mouse antibody against AOX. It can be used for AOX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquinol oxidase; EC 1.10.3.11; AOX
UniProt IDQ3LFQ3
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: MMLETVAAVPGMVGGMLLHLXSLXKFQHSGGWIKALMEEAENERMHLMTMVELVXPKWXERLLVLAXQGVFFNXFFALYILSPXAAHRIVGYXEEEAIXSYTQYLKXIERGAXENVPAPAIAIDYWRLPKDAXXKXVITVIRADEAHHRDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry