Mouse Anti-AP5S1 Antibody (CBMOAB-35956FYA)


Cat: CBMOAB-35956FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35956FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35956FYA 100 µg
CBMOAB-66079FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66079FYA 100 µg
MO-AB-07459R Monoclonal Cattle (Bos taurus) WB, ELISA MO07459R 100 µg
MO-AB-24095H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24095C 100 µg
MO-AB-26057W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26057W 100 µg
MO-AB-51041W Monoclonal Marmoset WB, ELISA MO51041W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35956FYA
SpecificityThis antibody binds to Rhesus AP5S1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAs part of AP-5, a probable fifth adaptor protein complex it may be involved in endosomal transport. According to PubMed:20613862, it is required for efficient homologous recombination DNA double-strand break repair.
Product OverviewMouse Anti-Rhesus AP5S1 Antibody is a mouse antibody against AP5S1. It can be used for AP5S1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP5S1
UniProt IDF7H0Z8
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLRLLARLLLDHLRLLAPGTNLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKELSAAWPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry