Mouse Anti-APBB2 Antibody (CBMOAB-35980FYA)


Cat: CBMOAB-35980FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35980FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO35980FYA 100 µg
MO-AB-01085W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01085W 100 µg
MO-AB-07466R Monoclonal Cattle (Bos taurus) WB, ELISA MO07466R 100 µg
MO-AB-23600W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23600W 100 µg
MO-AB-34399W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34399W 100 µg
MO-AB-51061W Monoclonal Marmoset WB, ELISA MO51061W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO35980FYA
SpecificityThis antibody binds to Rhesus APBB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. Polymorphisms in this gene have been associated with Alzheimer's disease. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus APBB2 Antibody is a mouse antibody against APBB2. It can be used for APBB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPBB2
UniProt IDF7E3Y6
Protein RefseqThe length of the protein is 736 amino acids long.
The sequence is show below: MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPTAVINITSEKLEGKEPHPQDSSGCEILPSQPRRTKSFLNYYADLETSARELEQNQGNRHGIAEEKSQPGQGQASTIIGNGDLLLQKPSKPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANANLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP.
For Research Use Only | Not For Clinical Use.
Online Inquiry