Mouse Anti-APBB3 Antibody (CBMOAB-35983FYA)


Cat: CBMOAB-35983FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35983FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Marmoset WB, ELISA MO35983FYA 100 µg
MO-AB-01088W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01088W 100 µg
MO-AB-07467R Monoclonal Cattle (Bos taurus) WB, ELISA MO07467R 100 µg
MO-AB-24097H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24097C 100 µg
MO-AB-24731W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24731W 100 µg
MO-AB-51065W Monoclonal Marmoset WB, ELISA MO51065W 100 µg
MO-DKB-01153W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Marmoset
CloneMO35983FYA
SpecificityThis antibody binds to Rhesus APBB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus APBB3 Antibody is a mouse antibody against APBB3. It can be used for APBB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPBB3
UniProt IDF7FWA9
Protein RefseqThe length of the protein is 484 amino acids long.
The sequence is show below: MLGKDYMLAIILVNCDDDLWGDQSLEGEPGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPAWELGDAEDPGTGTEGIWGLRPLKGRSFSSLESSLDRSNSLSWCGEESYIQNMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRSQPLDGAWGEGQNMLMILKKDAMSLVNPLDHSLIHCQPLVHIRVWGVGSSKGRDFAFVASDKDSCMLKCHVFRCDVPAKVIASALHGLCAQILSERVGVSVDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGTLTTRGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFLDAFRLKPSLLHMP.
For Research Use Only | Not For Clinical Use.
Online Inquiry