Mouse Anti-APH1A Antibody (CBMOAB-35992FYA)


Cat: CBMOAB-35992FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35992FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO35992FYA 100 µg
MO-AB-01485H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01485C 100 µg
MO-AB-07475R Monoclonal Cattle (Bos taurus) WB, ELISA MO07475R 100 µg
MO-AB-17401W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17401W 100 µg
MO-AB-24102H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24102C 100 µg
MO-AB-28986W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28986W 100 µg
MO-AB-51076W Monoclonal Marmoset WB, ELISA MO51076W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO35992FYA
SpecificityThis antibody binds to Rhesus APH1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus APH1A Antibody is a mouse antibody against APH1A. It can be used for APH1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPH1A
UniProt IDF7FDJ2
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry