Mouse Anti-APH1A Antibody (CBMOAB-35992FYA)
Cat: CBMOAB-35992FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35992FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO35992FYA | 100 µg | ||
| MO-AB-01485H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01485C | 100 µg | ||
| MO-AB-07475R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07475R | 100 µg | ||
| MO-AB-17401W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17401W | 100 µg | ||
| MO-AB-24102H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24102C | 100 µg | ||
| MO-AB-28986W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28986W | 100 µg | ||
| MO-AB-51076W | Monoclonal | Marmoset | WB, ELISA | MO51076W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO35992FYA |
| Specificity | This antibody binds to Rhesus APH1A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants. |
| Product Overview | Mouse Anti-Rhesus APH1A Antibody is a mouse antibody against APH1A. It can be used for APH1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | APH1A |
| UniProt ID | F7FDJ2 |
| Protein Refseq | The length of the protein is 190 amino acids long. The sequence is show below: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry