Mouse Anti-APH1B Antibody (CBMOAB-35993FYA)


Cat: CBMOAB-35993FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35993FYA Monoclonal Rhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35993FYA 100 µg
CBMOAB-66121FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66121FYA 100 µg
MO-AB-25121W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25121W 100 µg
MO-AB-51079W Monoclonal Marmoset WB, ELISA MO51079W 100 µg
MO-DKB-03572W Polyclonal C. elegans (Caenorhabditis elegans), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus) ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), C. elegans (Caenorhabditis elegans), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO35993FYA
SpecificityThis antibody binds to Rhesus APH1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein.
Product OverviewMouse Anti-Rhesus APH1B Antibody is a mouse antibody against APH1B. It can be used for APH1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPH1B
UniProt IDF7DK04
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGSFFWLVSLLISSLVWFMARVITDNKDGPTQKYLLIFGAFVSVYIQKMFRFAYYRLLKKASEGLKSINPGETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWCLLLIVLLTHLLVSAQTFISSYYGINLVSAFIILVLMGTWAFFVAGGSCRSLKLCLLCQDKDFLLYNQRSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry