Mouse Anti-APOC1 Antibody (CBMOAB-36061FYA)
Cat: CBMOAB-36061FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36061FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO36061FYA | 100 µg | ||
MO-AB-08986W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08986W | 100 µg | ||
MO-AB-22688W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22688W | 100 µg | ||
MO-AB-28994W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28994W | 100 µg | ||
MO-AB-24117H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24117C | 100 µg | ||
MO-AB-07231Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07231Y | 100 µg | ||
MOFY-0622-FY59 | Polyclonal | Rabbit | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY214 | Polyclonal | Dog | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
Clone | MO36061FYA |
Specificity | This antibody binds to Rhesus APOC1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. (From NCBI) |
Product Overview | Mouse Anti-Rhesus APOC1 Antibody is a mouse antibody against APOC1. It can be used for APOC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | APOC1 |
UniProt ID | F6Z2H8 |
Protein Refseq | The length of the protein is 65 amino acids long. The sequence is show below: MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALEKLKEFGNTLEDKAWEVINRIKQSEFPAKTR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry