Mouse Anti-APOC1 Antibody (CBMOAB-36061FYA)


Cat: CBMOAB-36061FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36061FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO36061FYA 100 µg
MO-AB-08986W Monoclonal Cat (Felis catus) WB, ELISA MO08986W 100 µg
MO-AB-22688W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22688W 100 µg
MO-AB-28994W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28994W 100 µg
MO-AB-24117H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24117C 100 µg
MO-AB-07231Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07231Y 100 µg
MOFY-0622-FY59 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY214 Polyclonal Dog WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO36061FYA
SpecificityThis antibody binds to Rhesus APOC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus APOC1 Antibody is a mouse antibody against APOC1. It can be used for APOC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPOC1
UniProt IDF6Z2H8
Protein RefseqThe length of the protein is 65 amino acids long.
The sequence is show below: MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALEKLKEFGNTLEDKAWEVINRIKQSEFPAKTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry