Mouse Anti-APOC4 Antibody (CBMOAB-36063FYA)


Cat: CBMOAB-36063FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36063FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO36063FYA 100 µg
MO-AB-07230Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07230Y 100 µg
MO-AB-07498R Monoclonal Cattle (Bos taurus) WB, ELISA MO07498R 100 µg
MO-AB-24120H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24120C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO36063FYA
SpecificityThis antibody binds to Rhesus APOC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene.
Product OverviewMouse Anti-Rhesus APOC4 Antibody is a mouse antibody against APOC4. It can be used for APOC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein C-IV; APOC4
UniProt IDH9F252
Protein RefseqThe length of the protein is 100 amino acids long.
The sequence is show below: QSEAYEGTPSPPPKLKMSHWSLVTGRMKELLEPVLNRTRDRWQWFWSPSTFRGFMQTYYDDHLRDLGPRTKAWLLKSKESLFNKTHSLCPRIVCGDKDQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry