Mouse Anti-APRT Antibody (MO-AB-07518R)


Cat: MO-AB-07518R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07518R Monoclonal Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Marmoset WB, ELISA MO07518R 100 µg
CBMOAB-01129FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO01129FYA 100 µg
MO-AB-42939W Monoclonal Hamsters (Cricetinae) WB, ELISA MO42939W 100 µg
MO-AB-51126W Monoclonal Marmoset WB, ELISA MO51126W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Marmoset
CloneMO07518R
SpecificityThis antibody binds to Cattle APRT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenine phosphoribosyltransferase belongs to the purine / pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle APRT Antibody is a mouse antibody against APRT. It can be used for APRT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenine phosphoribosyltransferase; APRT; EC 2.4.2.7; APRT
UniProt IDQ56JW4
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MADPELQLVARRIRSFPNFPIPGVLFRDISPVLKDPTSFRASINLLANHLKKAHGGRIDYIAGLDSRGFLFGPSLAQELGLGCILIRKRGKLPGPTVCASYALEYGKGELEIQRDALEPGQKVVVVDDLLATGGTMCAACELLGQLRAEVLECVSLVELTSLKGREKLGAVPFFSLLQYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry