Mouse Anti-Arabidopsis ACP1 Antibody (CBMOAB-1540FYC)


Cat: CBMOAB-1540FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1540FC
SpecificityThis antibody binds to Arabidopsis ACP1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Arabidopsis ACP1 (clone MO1540FC) Antibody (CBMOAB-1540FYC) is a mouse antibody against ACP1. It can be used for ACP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcid Phosphatase 1; Low Molecular Weight Phosphotyrosine Protein Phosphatase; Low Molecular Weight Cytosolic Acid Phosphatase; Acid Phosphatase Of Erythrocyte; Acid Phosphatase 1, Soluble; Red Cell Acid Phosphatase 1; Adipocyte Acid Phosphatase; LMW-PTPase; LMW-PTP
UniProt IDO22368
Protein RefseqThe length of the protein is 155 amino acids long. The sequence is show below: MCPSGRIAIPITTTANPNFRPAFEIIDTDHDGKISSDDLRAFYAGIPSGENNDETMIGTMISVADANKDGFVEFDEFEKVLETTPFSRSGNGGDDGLMKDVFKVMDKDGDGRLSYGDLKSYMDSAGLAVTDDEIKSMIRLAGGDLNDGVFLRRSA.
For Research Use Only | Not For Clinical Use.

Online Inquiry