Mouse Anti-Arabidopsis ACP4 Antibody (CBMOAB-1546FYC)


Cat: CBMOAB-1546FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1546FC
SpecificityThis antibody binds to Arabidopsis ACP4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAcid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. The protein encoded by this gene has structural similarity to prostatic and lysosomal acid phosphatases. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Product OverviewMouse Anti-Arabidopsis ACP4 (clone MO1546FC) Antibody (CBMOAB-1546FYC) is a mouse antibody against ACP4. It can be used for ACP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcid Phosphatase 4; Acid Phosphatase, Testicular; Testicular Acid Phosphatase; EC 3.1.3.2; ACPT; AI1J
UniProt IDQ9SW21
Protein RefseqThe length of the protein is 137 amino acids long. The sequence is show below: MASLSTTSLSFKAPSTTISQVLRKASSSQSVTFGRFTSSTKSLRLQISCAAKAETVQKVSDIVKEQLALAADVPLTAESKFSALGADSLDTVEIVMALEEKFNISVEESDAQNITTIQEAADLIEDLVQKKPAAETS.
For Research Use Only | Not For Clinical Use.

Online Inquiry