Mouse Anti-Arabidopsis AK6 Antibody (CBMOAB-1984FYC)


Cat: CBMOAB-1984FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1984FC
SpecificityThis antibody binds to Arabidopsis AK6.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Arabidopsis AK6 (clone MO1984FC) Antibody (CBMOAB-1984FYC) is a mouse antibody against AK6. It can be used for AK6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 6; Coilin Interacting Nuclear ATPase Protein; Adrenal Gland Protein AD-004; EC 2.7.4.3; HCINAP; CINAP; Coilin-Interacting Nuclear ATPase Protein; Dual Activity Adenylate Kinase/ATPase
UniProt IDQ38993
Protein RefseqThe length of the protein is 57 amino acids long. The sequence is show below: KASNILLDAEMEPKVADFGMARIFRVDQSRADTRKVVGTHGYISPEYLMHGQFSVKS.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry