Mouse Anti-Arabidopsis AK6 Antibody (CBMOAB-1984FYC)
Cat: CBMOAB-1984FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO1984FC |
Specificity | This antibody binds to Arabidopsis AK6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Arabidopsis AK6 Antibody is a mouse antibody against AK6. It can be used for AK6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 6; Coilin Interacting Nuclear ATPase Protein; Adrenal Gland Protein AD-004; EC 2.7.4.3; HCINAP; CINAP; Coilin-Interacting Nuclear ATPase Protein; Dual Activity Adenylate Kinase/ATPase |
UniProt ID | Q38993 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KASNILLDAEMEPKVADFGMARIFRVDQSRADTRKVVGTHGYISPEYLMHGQFSVKS. |
See other products for " Ak6 "
CBMOAB-00778FYA | Mouse Anti-D. melanogaster Ak6 Antibody (CBMOAB-00778FYA) |
MO-AB-00099Y | Mouse Anti-Chicken AK6 Antibody (MO-AB-00099Y) |
CBMOAB-65350FYA | Mouse Anti-Zebrafish ak6 Antibody (CBMOAB-65350FYA) |
MO-AB-07178R | Mouse Anti-Cattle AK6 Antibody (MO-AB-07178R) |
MO-AB-00030L | Mouse Anti-Elephant AK6 Antibody (MO-AB-00030L) |
MO-AB-00038R | Mouse Anti-Medaka AK6 Antibody (MO-AB-00038R) |
MO-AB-50644W | Mouse Anti-Marmoset AK6 Antibody (MO-AB-50644W) |
MO-AB-24018H | Mouse Anti-Rat Ak6 Antibody (MO-AB-24018H) |
MO-AB-07136Y | Mouse Anti-Rabbit AK6 Antibody (MO-AB-07136Y) |
MO-AB-10616Y | Mouse Anti-O. mykiss AK6 Antibody (MO-AB-10616Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry