Mouse Anti-Arabidopsis AT1G72165 / T9N14_2 / AT1G72170 Antibody (CBMOAB-0002FYC)


Cat: CBMOAB-0002FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0002FC
SpecificityThis antibody binds to Arabidopsis AT1G72165 / T9N14_2 / AT1G72170.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT1G72165 / T9N14_2 / AT1G72170 (clone MO0002FC) Antibody (CBMOAB-0002FYC) is a mouse antibody against AT1G72165 / T9N14_2 / AT1G72170. It can be used for AT1G72165 / T9N14_2 / AT1G72170 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein At1g72165/T9N14_2; Putative uncharacterized protein At1g72170; At1g72165/T9N14_2 At1g72170
UniProt IDQ8GWC7
Protein RefseqThe length of the protein is 102 amino acids long. The sequence is show below: MAEKKDSVPPEYDVNAKWDACLDLTVRRFVYSSLGGAFAGLLFFRSPVTRWASIALGAGIGIGSAYSDCSRAFDSPSSSSANLAAPKNNITETSPVSQAADE.
For Research Use Only | Not For Clinical Use.

Online Inquiry