Mouse Anti-Arabidopsis AT3G56575 / AT3G56580 Antibody (CBMOAB-0044FYC)


Cat: CBMOAB-0044FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0044FC
SpecificityThis antibody binds to Arabidopsis AT3G56575 / AT3G56580.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionE3 ubiquitin-protein ligase that promotes osmotic stress responses. Regulates negatively drought-mediated control of early seedling development, probably by influencing proline content, water loss, membrane ion leakage and the expression of dehydration stress-related genes (e.g. RAB18, RD29A, RD29B, AOX1A, ERD15, ERD1, COR15A, P5CS1 and P5CR).
Product OverviewMouse Anti-Arabidopsis AT3G56575 / AT3G56580 (clone MO0044FC) Antibody (CBMOAB-0044FYC) is a mouse antibody against AT3G56575 / AT3G56580. It can be used for AT3G56575 / AT3G56580 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin ligase; Putative uncharacterized protein At3g56580; RING finger family protein; At3g56575 At3g56580
UniProt IDQ94AK4
Protein RefseqThe length of the protein is 320 amino acids long. The sequence is show below: MSSIRNTHWCHRCQRAVWLRARDAVCSYCGGGFVEEIDIGPSRAHRDVERDPTFDLMEAFSAFMRSRLAERSYDREISGRLGSAGSESFSNLAPLLIFGGQAPFRLAGGDNSSVEAFVNGAAPGIGIARGTNAGDYFFGPGLEELIEQLSSGTHHRGPPPAPKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKSEAKQMPCHHIYHSDCIVPWLVQHNSCPVCRKELPSRGSSSSTQSSQNRSTNGRENSRRRNIFSNLWPFRSSSSSSTQNRRDTNNTATAEEGHYHHHQQQQQQHQHQHQQQQSHMGYSGWPFDY.
For Research Use Only | Not For Clinical Use.

Online Inquiry