Mouse Anti-Arabidopsis AT3G57790 Antibody (CBMOAB-0048FYC)


Cat: CBMOAB-0048FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0048FC
SpecificityThis antibody binds to Arabidopsis AT3G57790.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT3G57790 (clone MO0048FC) Antibody (CBMOAB-0048FYC) is a mouse antibody against AT3G57790. It can be used for AT3G57790 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein At3g57790; Putative uncharacterized protein At3g57790; F15B8.20; At3g57790 At3g57790/F15B8.20
UniProt IDQ8VZB7
Protein RefseqThe length of the protein is 325 amino acids long. The sequence is show below: MMGSILLLLLFFSLVQSRSDTSYSKIQLPGDSLTLSVTDFGATGDGINYDTSAIQSTIDACNRHYTSFSSICRVVFPSGNYLTAKLHLRSGVILDVTENAVLLGGPRIEDYYPAETSSDWYVVVANNATDVGITGGGAIDGQGSKFVVRFDEKKNVMVSWNQTGACLGDECRPRLVGFVDSINVEIWNITLREPAYWCLHIVRCENTSVHDVSILGDFNTPNNDGIDIEDSNNTVITRCHIDTGDDAICPKTYTGPLYNLTATDCWIRTKSSAIKLGSASWFDFKGLVFDNITIFESHRGLGMQIRDGGKQVSSFLWLHTTQKLM.
For Research Use Only | Not For Clinical Use.

Online Inquiry