Mouse Anti-Arabidopsis AT4G14615 Antibody (CBMOAB-0083FYC)


Cat: CBMOAB-0083FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0083FC
SpecificityThis antibody binds to Arabidopsis AT4G14615.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT4G14615 (clone MO0083FC) Antibody (CBMOAB-0083FYC) is a mouse antibody against AT4G14615. It can be used for AT4G14615 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAt4g14615; Putative uncharacterized protein At4g14615/FCAALL.205; At4g14615 At4g14615/FCAALL.205
UniProt IDQ8L9X5
Protein RefseqThe length of the protein is 76 amino acids long. The sequence is show below: MSSVGTSKGVLEIVKFGVYVAVPIVLMYTFANNSTNIKKFMGNRSYVVYPEEAPRPPSPDELREMARELARKKNIR.

Reference

Reference1. Thieme, C. J., Rojas-Triana, M., Stecyk, E., Schudoma, C., Zhang, W., Yang, L., ... & Kragler, F. (2015). Endogenous Arabidopsis messenger RNAs transported to distant tissues. Nature Plants, 1(4), 1-9.
2. Ascencio-Ibánez, J. T., Sozzani, R., Lee, T. J., Chu, T. M., Wolfinger, R. D., Cella, R., & Hanley-Bowdoin, L. (2008). Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant physiology, 148(1), 436-454.
For Research Use Only | Not For Clinical Use.

Online Inquiry