Mouse Anti-Arabidopsis AT4G21105 Antibody (CBMOAB-0101FYC)


Cat: CBMOAB-0101FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target
  • Reference

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0101FC
SpecificityThis antibody binds to Arabidopsis AT4G21105.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion; Vacuole; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFive proteins that play a role in respiration, namely cytochrome c oxidase At4g21105, ubiquinol-cytochrome c reductase complex ubiquinone binding protein At3g10860 and three components of mitochondrial complex I At2g27730, At2g47690 and At4g20150, Shows increased abundance under iron-deficient conditions.
Product OverviewMouse Anti-Arabidopsis AT4G21105 Antibody is a mouse antibody against AT4G21105. It can be used for AT4G21105 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAt4g21108/At4g21108; Cytochrome-c oxidase/ electron carrier; Putative uncharacterized protein At4g21105/F7J7.1; At4g21105 At4g21105/F7J7.1
UniProt IDQ944S8
Protein RefseqThe length of the protein is 68 amino acids long. The sequence is show below: MLTETPFRPREKLLEKQRLFQSIQRHTYLKGPMDKITSVAIPIALAASSLYMIGTGIYNMSNGIGKKE.

Reference

Reference1. Jobson, R. W., Nielsen, R., Laakkonen, L., Wikström, M., & Albert, V. A. (2004). Adaptive evolution of cytochrome c oxidase: infrastructure for a carnivorous plant radiation. Proceedings of the National Academy of Sciences, 101(52), 18064-18068.
2. Lan, P., Li, W., Wen, T. N., Shiau, J. Y., Wu, Y. C., Lin, W., & Schmidt, W. (2011). iTRAQ protein profile analysis of Arabidopsis roots reveals new aspects critical for iron homeostasis. Plant physiology, 155(2), 821-834.
For Research Use Only | Not For Clinical Use.
Online Inquiry