Mouse Anti-Arabidopsis AT4G21105 Antibody (CBMOAB-0101FYC)
Cat: CBMOAB-0101FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO0101FC |
Specificity | This antibody binds to Arabidopsis AT4G21105. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Mitochondrion; Vacuole; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Five proteins that play a role in respiration, namely cytochrome c oxidase At4g21105, ubiquinol-cytochrome c reductase complex ubiquinone binding protein At3g10860 and three components of mitochondrial complex I At2g27730, At2g47690 and At4g20150, Shows increased abundance under iron-deficient conditions. |
Product Overview | Mouse Anti-Arabidopsis AT4G21105 Antibody is a mouse antibody against AT4G21105. It can be used for AT4G21105 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | At4g21108/At4g21108; Cytochrome-c oxidase/ electron carrier; Putative uncharacterized protein At4g21105/F7J7.1; At4g21105 At4g21105/F7J7.1 |
UniProt ID | Q944S8 |
Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MLTETPFRPREKLLEKQRLFQSIQRHTYLKGPMDKITSVAIPIALAASSLYMIGTGIYNMSNGIGKKE. |
Reference
Reference | 1. Jobson, R. W., Nielsen, R., Laakkonen, L., Wikström, M., & Albert, V. A. (2004). Adaptive evolution of cytochrome c oxidase: infrastructure for a carnivorous plant radiation. Proceedings of the National Academy of Sciences, 101(52), 18064-18068. 2. Lan, P., Li, W., Wen, T. N., Shiau, J. Y., Wu, Y. C., Lin, W., & Schmidt, W. (2011). iTRAQ protein profile analysis of Arabidopsis roots reveals new aspects critical for iron homeostasis. Plant physiology, 155(2), 821-834. |
For Research Use Only | Not For Clinical Use.
Online Inquiry