Mouse Anti-Arabidopsis AT4G21105 Antibody (CBMOAB-0101FYC)


Cat: CBMOAB-0101FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0101FC
SpecificityThis antibody binds to Arabidopsis AT4G21105.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion; Vacuole; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT4G21105 (clone MO0101FC) Antibody (CBMOAB-0101FYC) is a mouse antibody against AT4G21105. It can be used for AT4G21105 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAt4g21108/At4g21108; Cytochrome-c oxidase/ electron carrier; Putative uncharacterized protein At4g21105/F7J7.1; At4g21105 At4g21105/F7J7.1
UniProt IDQ944S8
Protein RefseqThe length of the protein is 68 amino acids long. The sequence is show below: MLTETPFRPREKLLEKQRLFQSIQRHTYLKGPMDKITSVAIPIALAASSLYMIGTGIYNMSNGIGKKE.
For Research Use Only | Not For Clinical Use.

Online Inquiry