Mouse Anti-Arabidopsis AT4G29735 Antibody (CBMOAB-0124FYC)


Cat: CBMOAB-0124FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0124FC
SpecificityThis antibody binds to Arabidopsis AT4G29735.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT4G29735 (clone MO0124FC) Antibody (CBMOAB-0124FYC) is a mouse antibody against AT4G29735. It can be used for AT4G29735 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAt4g29735; Putative uncharacterized protein At4g29735; Putative uncharacterized protein At4g29735/T16L4.1; At4g29735 At4g29735/T16L4.1
UniProt IDQ8LCF2
Protein RefseqThe length of the protein is 76 amino acids long. The sequence is show below: MAAKPIASPIPVALYPTLSVFTLAIGLVITAIFFIYEATSSRKNRSVGKELATSAVASVFLGFGSLFLLLASGVYV.
For Research Use Only | Not For Clinical Use.

Online Inquiry