Cat: CBMOAB-0192FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO0192FC |
| Specificity | This antibody binds to Arabidopsis AT5G18020. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Functions as positive effectors of cell expansion through modulation of auxin transport. |
| Product Overview | Mouse Anti-Arabidopsis AT5G18020 (clone MO0192FC) Antibody (CBMOAB-0192FYC) is a mouse antibody against AT5G18020. It can be used for AT5G18020 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | At5g18020; Auxin-induced protein-like; Putative auxin-induced protein; SAUR-like auxin-responsive protein; At5g18020 At5g18020/MCM23_11 |
| UniProt ID | Q9FJG0 |
| Protein Refseq | The length of the protein is 91 amino acids long. The sequence is show below: MAFVRSLLGAKKILSRSTTAASAAPKGFLAVYVGESQKKRYLVPISYLNQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFINVTSRFQR. |
For Research Use Only | Not For Clinical Use.