Cat: CBMOAB-0193FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO0193FC |
Specificity | This antibody binds to Arabidopsis AT5G18030. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Functions as positive effectors of cell expansion through modulation of auxin transport. |
Product Overview | Mouse Anti-Arabidopsis AT5G18030 (clone MO0193FC) Antibody (CBMOAB-0193FYC) is a mouse antibody against AT5G18030. It can be used for AT5G18030 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | At5g18030; Auxin-induced protein-like; Putative auxin-induced protein; SAUR-like auxin-responsive protein; At5g18030 At5g18030/MCM23_13 |
UniProt ID | Q9FJF9 |
Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MALVRSLLGAKKILSRSTASAAPKGFLAVYVGESQKKRYLVPLSYLSQPSFQALLSKSEEEFGFDHPMGGLTIPCPEDTFINVTSRLQ. |
For Research Use Only | Not For Clinical Use.