Mouse Anti-Arabidopsis AT5G18150 Antibody (CBMOAB-0194FYC)


Cat: CBMOAB-0194FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO0194FC
SpecificityThis antibody binds to Arabidopsis AT5G18150.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT5G18150 (clone MO0194FC) Antibody (CBMOAB-0194FYC) is a mouse antibody against AT5G18150. It can be used for AT5G18150 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEmb|CAB87627.1; Methyltransferase-related protein; Putative uncharacterized protein At5g18150; Putative uncharacterized protein At5g18150/MRG7_11; At5g18150 At5g18150/MRG7_11
UniProt IDQ9FK55
Protein RefseqThe length of the protein is 76 amino acids long. The sequence is show below: MCPMRFLLVFFSAVLAGYFAWKTVSSSPEFDSPDELNEKQELNLKKKMENGFWVFVDMASGRYLWRNLKEMREKSQ.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry