Mouse Anti-Arabidopsis ATPA Antibody (CBMOAB-24868FYC)


Cat: CBMOAB-24868FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO24868FC
SpecificityThis antibody binds to Arabidopsis ATPA.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis ATPA (clone MO24868FC) Antibody (CBMOAB-24868FYC) is a mouse antibody against ATPA. It can be used for ATPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATPase alpha subunit; Fragment; atpA
UniProt IDQ3ZVE1
Protein RefseqThe length of the protein is 181 amino acids long. The sequence is show below: QTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTIXNQQGQNVICVYVAIGQKASSVAQVVTSLQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYREQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSXQLGEGSMTALPIVETQSGDVS.
For Research Use Only | Not For Clinical Use.

Online Inquiry