Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Arabidopsis BAG3 Antibody (CBMOAB-25039FYC)


Cat: CBMOAB-25039FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO25039FC
SpecificityThis antibody binds to Arabidopsis BAG3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
Product OverviewMouse Anti-Arabidopsis BAG3 (clone MO25039FC) Antibody (CBMOAB-25039FYC) is a mouse antibody against BAG3. It can be used for BAG3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCL2 Associated Athanogene 3; Bcl-2-Binding Protein Bis; Docking Protein CAIR-1; BAG-3; BIS; BAG Family Molecular Chaperone Regulator 3
UniProt IDQ9LYP4
Protein RefseqThe length of the protein is 303 amino acids long. The sequence is show below: MMKMNTGTSPSVIGGGTSGNEWESRPGGMVVQRRTDQNSDVPRVFRVRVKYGSVYHEININSQSSFGELKKMLSDQVGLHHEDMKVLYKDKERDSKMFLDLCGVKDRSKLVVKEDPISQEKRLLAKRKNAAIEKASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNSAKKVEVNKSVRHKPQTQTRFEQRDLLSFVEEEEEEPRNSNASSSSGTPAVVASKWEMFDSASTAKAAETVKPVPPRFKWEFFD.
For Research Use Only | Not For Clinical Use.

Online Inquiry