Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Arabidopsis BAP1 Antibody (CBMOAB-25062FYC)


Cat: CBMOAB-25062FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO25062FC
SpecificityThis antibody binds to Arabidopsis BAP1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the ubiquitin C-terminal hydrolase subfamily of deubiquitinating enzymes that are involved in the removal of ubiquitin from proteins. The encoded enzyme binds to the breast cancer type 1 susceptibility protein (BRCA1) via the RING finger domain of the latter and acts as a tumor suppressor. In addition, the enzyme may be involved in regulation of transcription, regulation of cell cycle and growth, response to DNA damage and chromatin dynamics. Germline mutations in this gene may be associated with tumor predisposition syndrome (TPDS), which involves increased risk of cancers including malignant mesothelioma, uveal melanoma and cutaneous melanoma.
Product OverviewMouse Anti-Arabidopsis BAP1 (clone MO25062FC) Antibody (CBMOAB-25062FYC) is a mouse antibody against BAP1. It can be used for BAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBRCA1 Associated Protein 1; BRCA1 Associated Protein-1 (Ubiquitin Carboxy-Terminal Hydrolase); Cerebral Protein 6; Ubiquitin Carboxyl-Terminal Hydrolase BAP1; Ubiquitin Carboxy-Terminal Hydrolase; BRCA1-Associated Protein 1; Cerebral Protein-13
UniProt IDF4JE67
Protein RefseqThe length of the protein is 178 amino acids long. The sequence is show below: MMTKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKCRKSNLDESRRSNPTWNYKSEMPINGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGIVNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQRQF.
For Research Use Only | Not For Clinical Use.

Online Inquiry