Mouse Anti-Arabidopsis CA2 Antibody (CBMOAB-25627FYC)


Cat: CBMOAB-25627FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO25627FC
SpecificityThis antibody binds to Arabidopsis CA2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Arabidopsis CA2 (clone MO25627FC) Antibody (CBMOAB-25627FYC) is a mouse antibody against CA2. It can be used for CA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbonic Anhydrase 2; Carbonic Anhydrase II; Carbonate Dehydratase II; Carbonic Anhydrase C; EC 4.2.1.1; CA-II; CAC; Epididymis Secretory Protein Li 282
UniProt IDA8MQY4
Protein RefseqThe length of the protein is 310 amino acids long. The sequence is show below: MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRMGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCERVRGSECVTSKPIDISICERRSCERNTCFEGRLL.
For Research Use Only | Not For Clinical Use.

Online Inquiry