Mouse Anti-Arabidopsis CDT1 Antibody (CBMOAB-25948FYC)


Cat: CBMOAB-25948FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO25948FC
SpecificityThis antibody binds to Arabidopsis CDT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein.
Product OverviewMouse Anti-Arabidopsis CDT1 Antibody is a mouse antibody against CDT1. It can be used for CDT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromatin Licensing And DNA Replication Factor 1; DUP; Double Parked, Drosophila, Homolog Of; DNA Replication Factor Cdt1; Double Parked Homolog; RIS2
UniProt IDF4IEL4
Protein RefseqThe length of the protein is 49 amino acids long. The sequence is show below: MKAPPQQEMTYYDNVKKRQDEQGCLFATFYALFCCCCCYEKCKCCCCCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry