Mouse Anti-Arabidopsis CDT1 Antibody (CBMOAB-25948FYC)
Cat: CBMOAB-25948FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO25948FC |
Specificity | This antibody binds to Arabidopsis CDT1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. |
Product Overview | Mouse Anti-Arabidopsis CDT1 Antibody is a mouse antibody against CDT1. It can be used for CDT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chromatin Licensing And DNA Replication Factor 1; DUP; Double Parked, Drosophila, Homolog Of; DNA Replication Factor Cdt1; Double Parked Homolog; RIS2 |
UniProt ID | F4IEL4 |
Protein Refseq | The length of the protein is 49 amino acids long. The sequence is show below: MKAPPQQEMTYYDNVKKRQDEQGCLFATFYALFCCCCCYEKCKCCCCCV. |
See other products for " CDT1 "
MO-AB-42995W | Mouse Anti-Hamsters CDT1 Antibody (MO-AB-42995W) |
MO-DKB-00349W | Rabbit Anti-cdt1 Antibody (MO-DKB-00349W) |
CBMOAB-38890FYA | Mouse Anti-Rhesus CDT1 Antibody (CBMOAB-38890FYA) |
CBMOAB-69970FYA | Mouse Anti-Zebrafish cdt1 Antibody (CBMOAB-69970FYA) |
MO-AB-16645W | Mouse Anti-Chimpanzee CDT1 Antibody (MO-AB-16645W) |
MO-AB-10009R | Mouse Anti-Cattle CDT1 Antibody (MO-AB-10009R) |
CBMOAB-01222HCB | Mouse Anti-C. elegans CDT1 Antibody (CBMOAB-01222HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry