Cat: CBMOAB-34632FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO34632FC |
Specificity | This antibody binds to Arabidopsis HMG1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Arabidopsis HMG1 (clone MO34632FC) Antibody (CBMOAB-34632FYC) is a mouse antibody against HMG1. It can be used for HMG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 3-hydroxy-3-methylglutaryl coenzyme A reductase isoform HMGR1L; Fragment; HMG1 |
UniProt ID | Q38812 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: MKKKQAGPQQTCEFVSYKTLLISPSHLSPHLTTSLLSPLSPPWRDYSFPPMDLRRRPPKPPVTNNNN. |
See other products for " HMG1 "
CBMOAB-23138FYB | Mouse Anti-Rice HMG1 Antibody (CBMOAB-23138FYB) |
CBMOAB-00036CR | Mouse Anti-Yeast HMG1 Antibody (CBMOAB-00036CR) |
CBMOAB-34631FYC | Mouse Anti-Arabidopsis HMG1 Antibody (CBMOAB-34631FYC) |
MO-AB-00567H | Mouse Anti-Arabidopsis HMG1 Antibody (MO-AB-00567H) |
For Research Use Only | Not For Clinical Use.