Mouse Anti-Arabidopsis HMG1 Antibody (CBMOAB-34632FYC)


Cat: CBMOAB-34632FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO34632FC
SpecificityThis antibody binds to Arabidopsis HMG1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis HMG1 (clone MO34632FC) Antibody (CBMOAB-34632FYC) is a mouse antibody against HMG1. It can be used for HMG1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names3-hydroxy-3-methylglutaryl coenzyme A reductase isoform HMGR1L; Fragment; HMG1
UniProt IDQ38812
Protein RefseqThe length of the protein is 67 amino acids long. The sequence is show below: MKKKQAGPQQTCEFVSYKTLLISPSHLSPHLTTSLLSPLSPPWRDYSFPPMDLRRRPPKPPVTNNNN.
For Research Use Only | Not For Clinical Use.

Online Inquiry