Mouse Anti-Arabidopsis MOCS2 Antibody (CBMOAB-36630FYC)
Cat: CBMOAB-36630FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO36630FC |
Specificity | This antibody binds to Arabidopsis MOCS2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. |
Product Overview | Mouse Anti-Arabidopsis MOCS2 Antibody is a mouse antibody against MOCS2. It can be used for MOCS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Molybdenum Cofactor Synthesis 2; MCBPE; MOCO1; Molybdenum Cofactor Synthesis Protein 2 Large Subunit; Molybdenum Cofactor Synthesis Protein 2 Small Subunit; Molybdopterin Synthase Sulfur Carrier Subunit; Molybdenum Cofactor Biosynthesis Protein E; Molybdopterin Synthase Catalytic Subunit; Molybdenum Cofactor Synthesis Protein 2A; Molybdenum Cofactor Synthesis Protein 2B; Molybdopterin-Synthase Large Subunit |
UniProt ID | O22827 |
Protein Refseq | The length of the protein is 198 amino acids long. The sequence is show below: MSAEEKNLIEILEEGHKVDVVKYIDYVSAPQAGAIATFSGTTRDMFEGKTVLELRYEAYVPMATRCLSSICTTARSTWDIHKIAVAHRLGPVPVGETSVLIAVSSVHRADGLDACKFLIDELKASVPIWKKEVYTNGEIWKENSEFMEKRLELAEKRDSIVKKTVVEEHRRRGCCGSKVRVEEDEEHKDITGDNKSSS. |
See other products for " Mocs2 "
MO-AB-27141H | Mouse Anti-Rat Mocs2 Antibody (MO-AB-27141H) |
CBMOAB-34678FYB | Mouse Anti-Rice MOCS2 Antibody (CBMOAB-34678FYB) |
MO-AB-16178Y | Mouse Anti-Sheep MOCS2 Antibody (MO-AB-16178Y) |
CBMOAB-24452FYA | Mouse Anti-D. melanogaster Mocs2 Antibody (CBMOAB-24452FYA) |
MO-AB-09168W | Mouse Anti-Cat MOCS2 Antibody (MO-AB-09168W) |
MO-AB-33419H | Mouse Anti-Nile tilapia mocs2 Antibody (MO-AB-33419H) |
MO-AB-45537W | Mouse Anti-Horse MOCS2 Antibody (MO-AB-45537W) |
MO-AB-35131W | Mouse Anti-Ferret MOCS2 Antibody (MO-AB-35131W) |
MO-AB-31813W | Mouse Anti-Dog MOCS2 Antibody (MO-AB-31813W) |
CBMOAB-87185FYA | Mouse Anti-Zebrafish mocs2 Antibody (CBMOAB-87185FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry