Mouse Anti-Arabidopsis PSAN Antibody (CBMOAB-39399FYC)


Cat: CBMOAB-39399FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO39399FC
SpecificityThis antibody binds to Arabidopsis PSAN.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay function in mediating the binding of the antenna complexes to the PSI reaction center and core antenna. Plays an important role in docking plastocyanin to the PSI complex. Does not bind pigments.
Product OverviewMouse Anti-Arabidopsis PSAN (clone MO39399FC) Antibody (CBMOAB-39399FYC) is a mouse antibody against PSAN. It can be used for PSAN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhotosystem I reaction center subunit N, chloroplastic; PSI-N; PSAN; At5g64040
UniProt IDP49107
Protein RefseqThe length of the protein is 171 amino acids long. The sequence is show below: MAAMNSSVLTCSYAIAGSGSVELNQKVGLVNSSVGFGQKKQMIMPVIKAQRVVGDDVDGSNGRRSAMVFLAATLFSTAAVSASANAGVIDEYLERSKTNKELNDKKRLATSGANFARAFTVQFGSCKFPENFTGCQDLAKQKKVPFISEDIALECEGKDKYKCGSNVFWKW.
For Research Use Only | Not For Clinical Use.

Online Inquiry