Mouse Anti-Arabidopsis RAE1 Antibody (CBMOAB-39768FYC)
Cat: CBMOAB-39768FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO39768FC |
| Specificity | This antibody binds to Arabidopsis RAE1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Product Overview | Mouse Anti-Arabidopsis RAE1 Antibody is a mouse antibody against RAE1. It can be used for RAE1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribonucleic Acid Export 1; Rae1 Protein Homolog; MRNP41; Homolog Of Yeast Rae1 (Bharathi) MRNA-Associated Protein Of 41 KDa (Kraemer); RAE1 (RNA Export 1, S.Pombe) Homolog; RAE1 RNA Export 1 Homolog (S. Pombe); MRNA-Associated Protein MRNP 41; MRNA-Associated Protein Mrnp 41; MRNA-Binding Protein, 41-KD |
| UniProt ID | Q38942 |
| Protein Refseq | The length of the protein is 349 amino acids long. The sequence is show below: MATFGAPATANSNPNKSYEVTPSPADSISSLSFSPRADILVATSWDNQVRCWEISRSGASLASAPKASISHDQPVLCSAWKDDGTTVFSGGCDKQAKMWPLLSGGQPVTVAMHEGPIAAMAWIPGMNLLATGSWDKTLKYWDTRQQNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVFNLQNPQTEFKRIQSPLKYQTRCVTAFPDQQGFLVGSIEGRVGVHHLDDSQQSKNFTFKCHRDGNDIYSVNSLNFHPVHGTFATAGSDGAFNFWDKDSKQRLKAMSRCNQPIPCSSFNHDGSIYAYAACYDWSKGAENHNPATAKSSIFLHLPQESEVKAKPRVGATGRK. |
See other products for " RAE1 "
| MO-AB-24080W | Mouse Anti-Chimpanzee RAE1 Antibody (MO-AB-24080W) |
| MO-AB-19003R | Mouse Anti-Cattle RAE1 Antibody (MO-AB-19003R) |
| MO-AB-62886W | Mouse Anti-Marmoset RAE1 Antibody (MO-AB-62886W) |
| CBMOAB-95170FYA | Mouse Anti-Zebrafish rae1 Antibody (CBMOAB-95170FYA) |
| MO-DKB-03387W | Rabbit Anti-RAE1 (C-terminal) Antibody (Cat MO-DKB-03387W) |
| MO-AB-42458W | Mouse Anti-Guinea pig RAE1 Antibody (MO-AB-42458W) |
| MO-AB-06878H | Mouse Anti-Frog Rae1 Antibody (MO-AB-06878H) |
| CBMOAB-28734FYA | Mouse Anti-D. melanogaster Rae1 Antibody (CBMOAB-28734FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry