Mouse Anti-Arabidopsis RPOC Antibody (CBMOAB-40515FYC)


Cat: CBMOAB-40515FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO40515FC
SpecificityThis antibody binds to Arabidopsis RPOC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Product OverviewMouse Anti-Arabidopsis RPOC Antibody is a mouse antibody against RPOC. It can be used for RPOC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA polymerase; Fragment; rpoC
UniProt IDQ31854
Protein RefseqThe length of the protein is 39 amino acids long. The sequence is show below: EFIPQSGISVEIPINGIFRRNSIFAFFDDPRYRRKSSGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry