Mouse Anti-Arabidopsis SCP2 Antibody (CBMOAB-41125FYC)


Cat: CBMOAB-41125FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO41125FC
SpecificityThis antibody binds to Arabidopsis SCP2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.
Product OverviewMouse Anti-Arabidopsis SCP2 (clone MO41125FC) Antibody (CBMOAB-41125FYC) is a mouse antibody against SCP2. It can be used for SCP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSterol Carrier Protein 2; Propanoyl-CoA C-Acyltransferase; Sterol Carrier Protein X; EC 2.3.1.176; SCP-CHI; NSL-TP
UniProt IDQ9FMN0
Protein RefseqThe length of the protein is 123 amino acids long. The sequence is show below: MANTQLKSDAIMDMMKEHLSTDAGKEVTEKIGLVYQINIAPKKLGFEEVTYIVDLKKGEVTKGKYEGGKVDATFSFKDDDFVKVATGKMNPQMAFIRGAMKIKGSLSAAQKFTPDIFPKPSKL.
For Research Use Only | Not For Clinical Use.

Online Inquiry