AibGenesis™ Mouse Anti-ARPC3 Antibody (CBMOAB-2686FYC)


Cat: CBMOAB-2686FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-2686FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO2686FC 100 µg
CBMOAB-36294FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36294FYA 100 µg
CBMOAB-66589FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66589FYA 100 µg
MO-AB-00085R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00085R 100 µg
MO-AB-06310Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06310Y 100 µg
MO-AB-07625R Monoclonal Cattle (Bos taurus) WB, ELISA MO07625R 100 µg
MO-AB-08841W Monoclonal Cat (Felis catus) WB, ELISA MO08841W 100 µg
MO-AB-10662Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10662Y 100 µg
MO-AB-21316W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21316W 100 µg
MO-AB-23871R Monoclonal Pig (Sus scrofa) WB, ELISA MO23871R 100 µg
MO-AB-24181H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24181C 100 µg
MO-AB-32851H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32851C 100 µg
MO-AB-34412W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34412W 100 µg
MO-AB-43728W Monoclonal Horse (Equus caballus) WB, ELISA MO43728W 100 µg
MO-DKB-02514W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO2686FC
SpecificityThis antibody binds to Arabidopsis ARPC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Arabidopsis ARPC3 Antibody is a mouse antibody against ARPC3. It can be used for ARPC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin Related Protein 2/3 Complex Subunit 3; Arp2/3 Complex 21 KDa Subunit; P21-Arc; ARC21; Actin Related Protein 2/3 Complex, Subunit 3 (21 KD); Actin Related Protein 2/3 Complex, Subunit 3, 21kDa; Actin Related Protein 2/3 Complex Subunit 3, 21kDa; Actin-Related Protein 2/3 Complex Subunit 3; ARP2/3 Protein Complex Subunit P21
UniProt IDQ1ECJ7
Protein RefseqThe length of the protein is 174 amino acids long. The sequence is show below: MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPVSEQDKTDIVDEAITFFRANVFFTNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAVGTKAIINLGLEDIPVPGETGFPFPGLFSLPQSQDEAELFRNYLKQVREETSGRLLSVAYRANGTPNKWWLAFAKRKFMNVVVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry