Mouse Anti-ARPC3 Antibody (CBMOAB-2686FYC)
Cat: CBMOAB-2686FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-2686FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO2686FC | 100 µg | ||
CBMOAB-36294FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36294FYA | 100 µg | ||
CBMOAB-66589FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66589FYA | 100 µg | ||
MO-AB-00085R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00085R | 100 µg | ||
MO-AB-06310Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06310Y | 100 µg | ||
MO-AB-07625R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07625R | 100 µg | ||
MO-AB-08841W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08841W | 100 µg | ||
MO-AB-10662Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10662Y | 100 µg | ||
MO-AB-21316W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21316W | 100 µg | ||
MO-AB-23871R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23871R | 100 µg | ||
MO-AB-24181H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24181C | 100 µg | ||
MO-AB-32851H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32851C | 100 µg | ||
MO-AB-34412W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34412W | 100 µg | ||
MO-AB-43728W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43728W | 100 µg | ||
MO-DKB-02514W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO2686FC |
Specificity | This antibody binds to Arabidopsis ARPC3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytoskeleton; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. |
Product Overview | Mouse Anti-Arabidopsis ARPC3 Antibody is a mouse antibody against ARPC3. It can be used for ARPC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Actin Related Protein 2/3 Complex Subunit 3; Arp2/3 Complex 21 KDa Subunit; P21-Arc; ARC21; Actin Related Protein 2/3 Complex, Subunit 3 (21 KD); Actin Related Protein 2/3 Complex, Subunit 3, 21kDa; Actin Related Protein 2/3 Complex Subunit 3, 21kDa; Actin-Related Protein 2/3 Complex Subunit 3; ARP2/3 Protein Complex Subunit P21 |
UniProt ID | Q1ECJ7 |
Protein Refseq | The length of the protein is 174 amino acids long. The sequence is show below: MVYHSSFVDEEGVTKACGCPLLPLKSHIKGPAPVSEQDKTDIVDEAITFFRANVFFTNFDIKSPADKLLIYLTFYINVALKRLEGCRTLAVGTKAIINLGLEDIPVPGETGFPFPGLFSLPQSQDEAELFRNYLKQVREETSGRLLSVAYRANGTPNKWWLAFAKRKFMNVVVL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry