Mouse Anti-ARRB1 Antibody (CBMOAB-36305FYA)


Cat: CBMOAB-36305FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36305FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO36305FYA 100 µg
CBMOAB-66610FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66610FYA 100 µg
MO-AB-01147W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01147W 100 µg
MO-AB-01616H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01616C 100 µg
MO-AB-07254Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07254Y 100 µg
MO-AB-07637R Monoclonal Cattle (Bos taurus) WB, ELISA MO07637R 100 µg
MO-AB-17518W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17518W 100 µg
MO-AB-51337W Monoclonal Marmoset WB, ELISA MO51337W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO36305FYA
SpecificityThis antibody binds to Rhesus ARRB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Plasma Membrane; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMembers of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.
Product OverviewMouse Anti-Rhesus ARRB1 Antibody is a mouse antibody against ARRB1. It can be used for ARRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARRB1
UniProt IDF7A773
Protein RefseqThe length of the protein is 411 amino acids long.
The sequence is show below: RVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADLALGVWDSVGKREALGVPLQVQRAGPQTSLPFRLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGCFGVVGACAYSPRAHPLTNPWTLCPPALCLVPENQTPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEENGTGSPQLNNR.
For Research Use Only | Not For Clinical Use.
Online Inquiry