Mouse Anti-ARRB1 Antibody (CBMOAB-36305FYA)
Cat: CBMOAB-36305FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36305FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO36305FYA | 100 µg | ||
CBMOAB-66610FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66610FYA | 100 µg | ||
MO-AB-01147W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01147W | 100 µg | ||
MO-AB-01616H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01616C | 100 µg | ||
MO-AB-07254Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07254Y | 100 µg | ||
MO-AB-07637R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07637R | 100 µg | ||
MO-AB-17518W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17518W | 100 µg | ||
MO-AB-51337W | Monoclonal | Marmoset | WB, ELISA | MO51337W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
Clone | MO36305FYA |
Specificity | This antibody binds to Rhesus ARRB1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Plasma Membrane; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. |
Product Overview | Mouse Anti-Rhesus ARRB1 Antibody is a mouse antibody against ARRB1. It can be used for ARRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ARRB1 |
UniProt ID | F7A773 |
Protein Refseq | The length of the protein is 411 amino acids long. The sequence is show below: RVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADLALGVWDSVGKREALGVPLQVQRAGPQTSLPFRLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGCFGVVGACAYSPRAHPLTNPWTLCPPALCLVPENQTPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEENGTGSPQLNNR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry