Mouse Anti-ARSE Antibody (CBMOAB-36319FYA)


Cat: CBMOAB-36319FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36319FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO36319FYA 100 µg
MO-AB-23876W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23876W 100 µg
MO-AB-29036W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29036W 100 µg
MO-AB-51348W Monoclonal Marmoset WB, ELISA MO51348W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset
CloneMO36319FYA
SpecificityThis antibody binds to Rhesus ARSE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionArylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the Y chromosome.
Product OverviewMouse Anti-Rhesus ARSE Antibody is a mouse antibody against ARSE. It can be used for ARSE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArylsulfatase E; ARSE
UniProt IDH9F3M8
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: LLLAGSYFVGALIVHADCLLMRNHTITEQPMRFQKTTPLILREVASFLKRNKHGPFLLFVSFLHVHIPLITMETFLGKSLHGLYGDNVEEMDWMVGQILDTLDMEGLTNSTLIYFTSDHGGSLENQLGRTQYGGWNGIYKGGKGMGGWEGGIRVPGIFRWPGVLPAGQVIGEPTSLMDVFPTVDQLAGGEVPQDRVIDGQDLLPLLLGTAQHSDHEFLMHYCEGFLHAARWHQRDKGTTWKVHFVTPVFQPEGAGACYGRKVCPCFGEKVLHHDPPLLFDLSRDPSETHVLTPASEPVFYQVMERVQRAVREHQRTLSPVPLQLDRLGNIWRPWLQPCCGPFPLCWCLREDGPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry