Mouse Anti-ASCL4 Antibody (CBMOAB-36377FYA)


Cat: CBMOAB-36377FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36377FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO36377FYA 100 µg
MO-AB-03401W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03401W 100 µg
MO-AB-24199H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24199C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO36377FYA
SpecificityThis antibody binds to Rhesus ASCL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBasic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).
Product OverviewMouse Anti-Rhesus ASCL4 Antibody is a mouse antibody against ASCL4. It can be used for ASCL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASCL4
UniProt IDF6RFT8
Protein RefseqThe length of the protein is 172 amino acids long.
The sequence is show below: METRKPAGLLALPYSLRAAPLGVPGTLAGLPRREPLRVALRLDAACWEWARSGCSRKRQFLPLPLDGAFEPACLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIGYIKHLQELLERQTRGPEGATGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry