Mouse Anti-ASF1A Antibody (CBMOAB-2733FYC)
Cat: CBMOAB-2733FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-2733FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO2733FC | 100 µg | ||
| MO-AB-07689R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07689R | 100 µg | ||
| MO-AB-12520W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12520W | 100 µg | ||
| MO-AB-14264Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14264Y | 100 µg | ||
| MO-AB-24201H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24201C | 100 µg | ||
| MO-AB-51387W | Monoclonal | Marmoset | WB, ELISA | MO51387W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO2733FC |
| Specificity | This antibody binds to Arabidopsis ASF1A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis ASF1A Antibody is a mouse antibody against ASF1A. It can be used for ASF1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Anti-Silencing Function 1A Histone Chaperone; Anti-Silencing Function Protein 1 Homolog A; CCG1-Interacting Factor A; HAsf1a; HAsf1; HCIA; CIA |
| UniProt ID | Q9C9M6 |
| Protein Refseq | The length of the protein is 196 amino acids long. The sequence is show below: MSAIKITNVAVLHNPAPFVSPFQFEISYECLNSLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVFQADPPDPSKIQEEDIIGVTVLLLTCSYMGQEFLRVGYYVNNDYEDEQLKEEPPTKVLIDKVQRNILSDKPRVTKFPIDFHPEEEQTAATAAPPEQSDEQQPNVNGEAQVLPDQSVEPKPEES. |
For Research Use Only | Not For Clinical Use.
Online Inquiry