Mouse Anti-ASF1B Antibody (CBMOAB-2734FYC)
Cat: CBMOAB-2734FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-2734FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO2734FC | 100 µg | ||
| CBMOAB-36379FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36379FYA | 100 µg | ||
| MO-AB-12522W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12522W | 100 µg | ||
| MO-AB-07690R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07690R | 100 µg | ||
| MO-AB-23889R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23889R | 100 µg | ||
| MO-AB-00085H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00085C | 100 µg | ||
| MO-AB-24202H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24202C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO2734FC |
| Specificity | This antibody binds to Arabidopsis ASF1B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis ASF1B Antibody is a mouse antibody against ASF1B. It can be used for ASF1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Anti-Silencing Function 1B Histone Chaperone; Anti-Silencing Function Protein 1 Homolog B; CCG1-Interacting Factor A-II; HCIA-II; CIA-II; HAsf1b |
| UniProt ID | Q9LS09 |
| Protein Refseq | The length of the protein is 218 amino acids long. The sequence is show below: MSSINITNVTVLDNPAPFVNPFQFEISYECLTSLKDDLEWKLIYVGSAEDETYDQVLESVLVGPVNVGNYRFVLQADSPDPLKIREEDIIGVTVLLLTCSYMDQEFIRVGYYVNNDYDDEQLREEPPTKVLIDKVQRNILTDKPRVTKFPINFHPENEQTLGDGPAPTEPFADSVVNGEAPVFLEQPQKLQEIEQFDDSDVNGEAIALLDQPQNLQET. |
For Research Use Only | Not For Clinical Use.
Online Inquiry