AibGenesis™ Mouse Anti-ASMT Antibody (CBMOAB-36384FYA)


Cat: CBMOAB-36384FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36384FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO36384FYA 100 µg
CBMOAB-66777FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66777FYA 100 µg
MO-AB-00193Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00193Y 100 µg
MO-AB-03402W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03402W 100 µg
MO-AB-07699R Monoclonal Cattle (Bos taurus) WB, ELISA MO07699R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO36384FYA
SpecificityThis antibody binds to Rhesus ASMT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ASMT Antibody is a mouse antibody against ASMT. It can be used for ASMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcetylserotonin O-methyltransferase; ASMT
UniProt IDH9H5B3
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: RSEGERLQFMQALQEVWSVNGRSVLTAFDLSGFPLMCDLGGGPGALAKECLSLYPGCKVTVFDVPEVVRTAKQHFSFPEEEEIHLQEGDFFKDPLPEADLYILARILHDWADGKCSHLLERVYHTCKPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry