Mouse Anti-ASPG Antibody (CBMOAB-36390FYA)


Cat: CBMOAB-36390FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36390FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO36390FYA 100 µg
CBMOAB-66795FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66795FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO36390FYA
SpecificityThis antibody binds to Rhesus ASPG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionExhibits lysophospholipase, transacylase, PAF acetylhydrolase and asparaginase activities.
Product OverviewMouse Anti-Rhesus ASPG Antibody is a mouse antibody against ASPG. It can be used for ASPG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASPG
UniProt IDF7BSN9
Protein RefseqThe length of the protein is 464 amino acids long.
The sequence is show below: AGPSPPLRAAVGRRLLGVAHPDPHPRPCGELQVEGPGPVPGMLRVCCVQSPWRRGPTSARGEQSRSGHLEVQSRSLQFRLLLFPSRSPATPNQRILYTVLECQPLFDSSDMTIAEWVRVAQTIERHYKQYHGFVVIHGTDTMAFAASMLSFMLENLQKTVILTGAQVSIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADVTVNRELVRKVGGKAGLVVHSSMEQDVGLLRLYPGIPAALVRAFLQPPLKGMVMETFGSGNGPTKPDLLQELQMATKRGLVIVNCTHCLQGTVTTDYAAGMAMEGAGVISGFDMTSEAALAKLSYVLGQPGLSLDDRKELLTKDLRGEMTPPSVEECQPSLQGNTLGCGVSWLLSLSGSQEADALRNALMPSLACAAAHTGNLEVLQVLVELGSDLGLVDFNGQTPLHAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry