Mouse Anti-ASRGL1 Antibody (CBMOAB-36411FYA)


Cat: CBMOAB-36411FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36411FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Zebrafish (Danio rerio) WB, ELISA MO36411FYA 100 µg
CBMOAB-66824FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66824FYA 100 µg
MO-AB-07718R Monoclonal Cattle (Bos taurus) WB, ELISA MO07718R 100 µg
MO-AB-34422W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34422W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Zebrafish (Danio rerio)
CloneMO36411FYA
SpecificityThis antibody binds to Rhesus ASRGL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHas both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.
Product OverviewMouse Anti-Rhesus ASRGL1 Antibody is a mouse antibody against ASRGL1. It can be used for ASRGL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASRGL1
UniProt IDF6S3A3
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MPWRELWSPWKTIPSSTQTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTEKNKKRLEKEKHEKGAQKTDCEKNLGTVGAVALDFKGNVAYATSTGGIVNKMVGRVGDTPCVGAGGYADNDIGAISTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTAITDLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry