Mouse Anti-ATP10A Antibody (CBMOAB-36525FYA)


Cat: CBMOAB-36525FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36525FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO36525FYA 100 µg
CBMOAB-66973FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66973FYA 100 µg
MO-AB-16689W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16689W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO36525FYA
SpecificityThis antibody binds to Rhesus ATP10A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'. (From NCBI)
Product OverviewMouse Anti-Rhesus ATP10A Antibody is a mouse antibody against ATP10A. It can be used for ATP10A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative phospholipid-transporting ATPase VA; ATP10A
UniProt IDH9FJ53
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: VIYAGHETKALLNNSGPRYKRSKLERQMNCDVLWCVLLLVCMSLFSAVGHGLWIWRYQEKKSLFYVPTSDGSSLSPVTAAVYSFLTMIIVLQVLIPISLYVSIEIVKACQVYFINQDVQLYDEETDSQLQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry