Mouse Anti-ATP6V0D1 Antibody (CBMOAB-36596FYA)
Cat: CBMOAB-36596FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36596FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO36596FYA | 100 µg | ||
CBMOAB-67137FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67137FYA | 100 µg | ||
MO-AB-01740H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01740C | 100 µg | ||
MO-AB-07843R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07843R | 100 µg | ||
MO-AB-23614W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23614W | 100 µg | ||
MO-AB-51588W | Monoclonal | Marmoset | WB, ELISA | MO51588W | 100 µg | ||
MO-DKB-03480W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset |
Clone | MO36596FYA |
Specificity | This antibody binds to Rhesus ATP6V0D1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. (From NCBI) |
Product Overview | Mouse Anti-Rhesus ATP6V0D1 Antibody is a mouse antibody against ATP6V0D1. It can be used for ATP6V0D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP6V0D1 |
UniProt ID | F6RML0 |
Protein Refseq | The length of the protein is 187 amino acids long. The sequence is show below: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry