Mouse Anti-Aven Antibody (CBMOAB-02093FYA)
Cat: CBMOAB-02093FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02093FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO02093FYA | 100 µg | ||
| CBMOAB-36659FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36659FYA | 100 µg | ||
| CBMOAB-67245FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67245FYA | 100 µg | ||
| MO-AB-00238Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00238Y | 100 µg | ||
| MO-AB-01770H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01770C | 100 µg | ||
| MO-AB-22060W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22060W | 100 µg | ||
| MO-AB-24281H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24281C | 100 µg | ||
| MO-AB-51655W | Monoclonal | Marmoset | WB, ELISA | MO51655W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO02093FYA |
| Specificity | This antibody binds to fruit fly Aven. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-D. melanogaster Aven Antibody is a mouse antibody against Aven. It can be used for Aven detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Aven ortholog, isoform B; CG15727-PA; RE13534p; Aven |
| UniProt ID | Q9VYK8 |
| Protein Refseq | The length of the protein is 294 amino acids long. The sequence is show below: MSGKDDRSKEKRRNMKQYNHHHKKDQGRSTTSSGSPPPTSRRSMVDVADSSDEPRLARRGNWQSSGAGRSSLAPQRNRDMLDTLPSDTDDVEQLGLDGAPIDENARAQLRAGDFQQLAQFPSLGGGHFTFGSEREWANVAEGQTKLHTKAASAYFTLNLTRLNVGLQTIPLYKRMDYPASLFTRAQIAAQEKAAERAEAVYQQCILKDANGGAKSRAPSAKSNKDVAPAAAEKPIAASAAEPDELDELLAMTDTQLDIGSGTITMPMPMVQPATPSSAASKNGVEEWLDSVLDE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry