Mouse Anti-Aven Antibody (CBMOAB-02093FYA)


Cat: CBMOAB-02093FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02093FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO02093FYA 100 µg
CBMOAB-36659FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36659FYA 100 µg
CBMOAB-67245FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67245FYA 100 µg
MO-AB-00238Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00238Y 100 µg
MO-AB-01770H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01770C 100 µg
MO-AB-22060W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22060W 100 µg
MO-AB-24281H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24281C 100 µg
MO-AB-51655W Monoclonal Marmoset WB, ELISA MO51655W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO02093FYA
SpecificityThis antibody binds to fruit fly Aven.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Aven Antibody is a mouse antibody against Aven. It can be used for Aven detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAven ortholog, isoform B; CG15727-PA; RE13534p; Aven
UniProt IDQ9VYK8
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: MSGKDDRSKEKRRNMKQYNHHHKKDQGRSTTSSGSPPPTSRRSMVDVADSSDEPRLARRGNWQSSGAGRSSLAPQRNRDMLDTLPSDTDDVEQLGLDGAPIDENARAQLRAGDFQQLAQFPSLGGGHFTFGSEREWANVAEGQTKLHTKAASAYFTLNLTRLNVGLQTIPLYKRMDYPASLFTRAQIAAQEKAAERAEAVYQQCILKDANGGAKSRAPSAKSNKDVAPAAAEKPIAASAAEPDELDELLAMTDTQLDIGSGTITMPMPMVQPATPSSAASKNGVEEWLDSVLDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry