AibGenesis™ Mouse Anti-AVP Antibody (CBMOAB-36664FYA)
Cat: CBMOAB-36664FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36664FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO36664FYA | 100 µg | ||
| CBMOAB-67251FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67251FYA | 100 µg | ||
| MO-AB-00146L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00146L | 100 µg | ||
| MO-AB-07904R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07904R | 100 µg | ||
| MO-AB-24043R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24043R | 100 µg | ||
| MO-AB-24282H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24282C | 100 µg | ||
| MO-AB-41305W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41305W | 100 µg | ||
| MO-AB-43828W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43828W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO36664FYA |
| Specificity | This antibody binds to Rhesus AVP. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin is a posterior pituitary hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). This gene is present in a gene cluster with the related gene oxytocin on chromosome 20. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus AVP Antibody is a mouse antibody against AVP. It can be used for AVP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | AVP |
| UniProt ID | F7AY92 |
| Protein Refseq | The length of the protein is 165 amino acids long. The sequence is show below: MLLPELPEGRQEGHVRPGAETVPPLRPRGQRPLLRAQHLLRGRAGLLCGHSRGAALPGGELPAFALPVRPEGVRERGPLRRLRHLLQRRELHDGARLPRGLSPPRPRQRPEQRHAAGRAGRGLAAAAGAAGRGARALRARPARRLLSPPPALPARCLRPPLQHGQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry