Mouse Anti-AVP Antibody (CBMOAB-36664FYA)


Cat: CBMOAB-36664FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36664FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36664FYA 100 µg
CBMOAB-67251FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67251FYA 100 µg
MO-AB-00146L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00146L 100 µg
MO-AB-07904R Monoclonal Cattle (Bos taurus) WB, ELISA MO07904R 100 µg
MO-AB-24043R Monoclonal Pig (Sus scrofa) WB, ELISA MO24043R 100 µg
MO-AB-24282H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24282C 100 µg
MO-AB-41305W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41305W 100 µg
MO-AB-43828W Monoclonal Horse (Equus caballus) WB, ELISA MO43828W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36664FYA
SpecificityThis antibody binds to Rhesus AVP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin is a posterior pituitary hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). This gene is present in a gene cluster with the related gene oxytocin on chromosome 20.
Product OverviewMouse Anti-Rhesus AVP Antibody is a mouse antibody against AVP. It can be used for AVP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAVP
UniProt IDF7AY92
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MLLPELPEGRQEGHVRPGAETVPPLRPRGQRPLLRAQHLLRGRAGLLCGHSRGAALPGGELPAFALPVRPEGVRERGPLRRLRHLLQRRELHDGARLPRGLSPPRPRQRPEQRHAAGRAGRGLAAAAGAAGRGARALRARPARRLLSPPPALPARCLRPPLQHGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry