Mouse Anti-B4GALT1 Antibody (CBMOAB-36715FYA)


Cat: CBMOAB-36715FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36715FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO36715FYA 100 µg
CBMOAB-67336FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67336FYA 100 µg
MO-AB-07934R Monoclonal Cattle (Bos taurus) WB, ELISA MO07934R 100 µg
MO-AB-14337Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14337Y 100 µg
MO-AB-22734W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22734W 100 µg
MO-AB-24307H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24307C 100 µg
MO-AB-36752W Monoclonal Goat (Capra hircus) WB, ELISA MO36752W 100 µg
MO-AB-51694W Monoclonal Marmoset WB, ELISA MO51694W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO36715FYA
SpecificityThis antibody binds to Rhesus B4GALT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase.
Product OverviewMouse Anti-Rhesus B4GALT1 Antibody is a mouse antibody against B4GALT1. It can be used for B4GALT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB4GALT1
UniProt IDF7H9T4
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MRFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTSLQGGSNGAAAIGQPSGELGTRGARPPPPLGASSQPRPAGDSSPVAASGPGPASNLTSVPVPQTTSLPLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYTPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQYEKIRRLPGMKASPGLFLSGGGRAWWLVLASSWRFEHETCWPCELCHLRRIGQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry