Mouse Anti-B4GALT1 Antibody (CBMOAB-36715FYA)
Cat: CBMOAB-36715FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36715FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO36715FYA | 100 µg | ||
CBMOAB-67336FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67336FYA | 100 µg | ||
MO-AB-07934R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07934R | 100 µg | ||
MO-AB-14337Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14337Y | 100 µg | ||
MO-AB-22734W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22734W | 100 µg | ||
MO-AB-24307H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24307C | 100 µg | ||
MO-AB-36752W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36752W | 100 µg | ||
MO-AB-51694W | Monoclonal | Marmoset | WB, ELISA | MO51694W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO36715FYA |
Specificity | This antibody binds to Rhesus B4GALT1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase. |
Product Overview | Mouse Anti-Rhesus B4GALT1 Antibody is a mouse antibody against B4GALT1. It can be used for B4GALT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | B4GALT1 |
UniProt ID | F7H9T4 |
Protein Refseq | The length of the protein is 270 amino acids long. The sequence is show below: MRFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTSLQGGSNGAAAIGQPSGELGTRGARPPPPLGASSQPRPAGDSSPVAASGPGPASNLTSVPVPQTTSLPLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYTPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQYEKIRRLPGMKASPGLFLSGGGRAWWLVLASSWRFEHETCWPCELCHLRRIGQS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry