Mouse Anti-Barrel medic ndhH Antibody (MO-AB-00382W)


Cat: MO-AB-00382W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula)
CloneMO00382W
SpecificityThis antibody binds to Barrel medic ndhH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.
Product OverviewMouse Anti-Barrel medic ndhH Antibody is a mouse antibody against ndhH. It can be used for ndhH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNADH-quinone oxidoreductase subunit D; EC 1.6.99.5; NADH dehydrogenase I subunit D; NDH-1 subunit D; ndhH; nuoD
UniProt IDS4SZH9
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MNVPATRKDLMIVNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITVNGPEQLGNIQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYIFRERELIYDLFEAATGMRMMHNYFRIGGVAADLPYGWIDKCFDFCNYFLTRVIEYQKLITRNPIFLERVEAVGVVGREEVINWGLSGPMLRASGIQWDLRKVDNYECYEEFDWEVQWQKEGDSLARYLVRIGEMMESIKIIQQALEGIPGGPYENLEIRSFDREKEPEWNDFEYRFIGKKSSPTFELPKQELYVRVEAPKGELGIFLLGDQNGFPWRWKIRPPGFINLQILPQLVKRMKLADIMTILGSIDIIMGEVDR.
For Research Use Only | Not For Clinical Use.
Online Inquiry