AibGenesis™ Mouse Anti-BASP1 Antibody (CBMOAB-36777FYA)


Cat: CBMOAB-36777FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36777FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36777FYA 100 µg
CBMOAB-67448FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67448FYA 100 µg
MO-AB-01805H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01805C 100 µg
MO-AB-07971R Monoclonal Cattle (Bos taurus) WB, ELISA MO07971R 100 µg
MO-AB-17700W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17700W 100 µg
MO-AB-24321H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24321C 100 µg
MO-AB-51747W Monoclonal Marmoset WB, ELISA MO51747W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36777FYA
SpecificityThis antibody binds to Rhesus BASP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. Alternative splicing results in multiple transcript variants that encode the same protein. (From NCBI)
Product OverviewMouse Anti-Rhesus BASP1 Antibody is a mouse antibody against BASP1. It can be used for BASP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBASP1
UniProt IDF7HN33
Protein RefseqThe length of the protein is 227 amino acids long.
The sequence is show below: MGGKLSKKKKGYNVNDEKAKDKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGKAPKAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQAPAASAEEPKPVEAPAANSDQTVAVKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry