AibGenesis™ Mouse Anti-BBS12 Antibody (CBMOAB-36804FYA)


Cat: CBMOAB-36804FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36804FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36804FYA 100 µg
CBMOAB-67494FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67494FYA 100 µg
MO-AB-07982R Monoclonal Cattle (Bos taurus) WB, ELISA MO07982R 100 µg
MO-AB-26176W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26176W 100 µg
MO-AB-51762W Monoclonal Marmoset WB, ELISA MO51762W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO36804FYA
SpecificityThis antibody binds to Rhesus BBS12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is part of a complex that is involved in membrane trafficking. The encoded protein is a molecular chaperone that aids in protein folding upon ATP hydrolysis. This protein also plays a role in adipocyte differentiation. Defects in this gene are a cause of Bardet-Biedl syndrome type 12. Two transcript variants encoding the same protein have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus BBS12 Antibody is a mouse antibody against BBS12. It can be used for BBS12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBBS12
UniProt IDF7H903
Protein RefseqThe length of the protein is 671 amino acids long.
The sequence is show below: MVMACRVINKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESLDLSSAVGQLLNEAVQAQNNTYRIGTSTLLFLVGAWSSAVEECLHLGVPISVIVSVMSEGLKFCSEEVVSLQVPVHNIFDCMDSTKTFPQLETFSVSLCPFLQVPSDTDLIEEEHGLRDVASQTLTISNLSGRLLKSSEFFKPQAKVEADKNTSRTLKNSLLADTCCRKSILIHSRHFNGTDNTEWVSKPDGFQEHVTATLKTYRCNDLVELAVGLSHGDHSSMKLVEEAVQLQYQNACVQQGNCIKPFMFDISRICTCCLPGLPETSSCVCPGYITVVSVSNTPVIKELQNQPLRVVLIEGDLTENYRHLGFNKSVNIKTALTSMELQEDSSEELWANHVLQVLIQFNVNLVLVQGNVSERLIEKCLNSKQLVIGSVNGSVMQAFAEAAGAVQVAYITQVNEDCVGNGVCVTFWRSKTEGINLVTAVLTNPVTAQMQTKEDRFWTCAYRLYYALKEEKVFLGGGAVEFLCHNTSSWLASSLAIYRPTVLKFLANGWQKYLSTLLYNTAHYSSEFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRILNSDISNKLEQIPRVYDVVTAKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFLFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry