Mouse Anti-BLNK Antibody (CBMOAB-37001FYA)


Cat: CBMOAB-37001FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37001FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO37001FYA 100 µg
CBMOAB-67719FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67719FYA 100 µg
MO-AB-01311W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01311W 100 µg
MO-AB-01874H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01874C 100 µg
MO-AB-08103R Monoclonal Cattle (Bos taurus) WB, ELISA MO08103R 100 µg
MO-AB-51882W Monoclonal Marmoset WB, ELISA MO51882W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO37001FYA
SpecificityThis antibody binds to Rhesus BLNK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus BLNK Antibody is a mouse antibody against BLNK. It can be used for BLNK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBLNK
UniProt IDF7EYN2
Protein RefseqThe length of the protein is 442 amino acids long.
The sequence is show below: RQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYVDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPRVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPERAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPSPAAPSPLPRAGKKPMTPLKTTPVASQQNTSSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQLHQKPIPLPRFTEGGNPTVDGPVPSFSSNSTISEQEAGVLCKPWYAGDCDRKSAEEALHRSNKGDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIKNHQHSPLVLIDSQNNTKDSTRLKYAVKVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry